Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Recombinant Protein
CAT#: TP310481
Recombinant protein of human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1, 20 µg
View other "Macrophage Inflammatory Protein 1 beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210481 protein sequence
Red=Cloning site Green=Tags(s) MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS KQVCADPSESWVQEYVYDLELN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002975 |
Locus ID | 6351 |
UniProt ID | P13236 |
Refseq Size | 667 |
Cytogenetics | 17q12 |
Refseq ORF | 276 |
Synonyms | ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4 |
Summary | The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401043 | CCL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401043 | Transient overexpression lysate of chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1 |
CN¥ 3,080.00 |
|
PH310481 | CCL4 MS Standard C13 and N15-labeled recombinant protein (NP_002975) |
CN¥ 19,520.00 |
其它Macrophage Inflammatory Protein 1 beta产品