HMG14 (HMGN1) (NM_004965) Human Recombinant Protein
CAT#: TP310454
Recombinant protein of human high-mobility group nucleosome binding domain 1 (HMGN1), 20 µg
View other "HMG14" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210454 protein sequence
Red=Cloning site Green=Tags(s) MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEANPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET KEDLPAENGETKTEESPASDEAGEKEAKSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004956 |
Locus ID | 3150 |
UniProt ID | P05114, Q6NSG7 |
Refseq Size | 1313 |
Cytogenetics | 21q22.2 |
Refseq ORF | 300 |
Synonyms | HMG14 |
Summary | The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417625 | HMGN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417625 | Transient overexpression lysate of high-mobility group nucleosome binding domain 1 (HMGN1) |
CNY 3,080.00 |
|
PH310454 | HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956) |
CNY 14,250.00 |