TBC1D24 (NM_020705) Human Recombinant Protein
CAT#: TP310346
Recombinant protein of human TBC1 domain family, member 24 (TBC1D24), 20 µg
View other "TBC1D24" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210346 protein sequence
Red=Cloning site Green=Tags(s) MDSPGYNCFVDKDKMDAAIQDLGPKELSCTELQELKQLARQGYWAQSHALRGKVYQRLIRDIPCRTVTPD ASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPDISFCPALPAVVAL LLHYSIDEAECFEKACRILACNDPGRRLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYA DWQRWLFGELPLCYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDSVKQDIRTFVRDIAKTV SPEKLLEKAFAIRLFSRKEIQLLQMANEKALKQKGITVKQKRQFVHLAVHAENFRSEIVSVREMRDIWSW VPERFALCQPLLLFSSLQHGYSLARFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERNKFGGKLGFFG TGECFVFRLQPEVQRYEWVVIKHPELTKPPPLMAAEPTAPLSHSASSDPADRLSPFLAARHFNLPSKTES MFMAGGSDCLIVGGGGGQALYIDGDLNRGRTSHCDTFNNQPLCSENFLIAAVEAWGFQDPDTQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065756 |
Locus ID | 57465 |
UniProt ID | Q9ULP9 |
Refseq Size | 6589 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1659 |
Synonyms | DEE16; DFNA65; DFNB86; DOORS; EIEE16; EPRPDC; FIME; TLDC6 |
Summary | This gene encodes a protein with a conserved domain, referred to as the TBC domain, characteristic of proteins which interact with GTPases. TBC domain proteins may serve as GTPase-activating proteins for a particular group of GTPases, the Rab (Ras-related proteins in brain) small GTPases which are involved in the regulation of membrane trafficking. Mutations in this gene are associated with familial infantile myoclonic epilepsy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412201 | TBC1D24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434311 | TBC1D24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412201 | Transient overexpression lysate of TBC1 domain family, member 24 (TBC1D24) |
CNY 3,080.00 |
|
LY434311 | Transient overexpression lysate of TBC1 domain family, member 24 (TBC1D24), transcript variant 1 |
CNY 3,080.00 |
|
PH310346 | TBC1D24 MS Standard C13 and N15-labeled recombinant protein (NP_065756) |
CNY 19,520.00 |
其它TBC1D24产品