CA8 (NM_004056) Human Recombinant Protein
CAT#: TP310228
Recombinant protein of human carbonic anhydrase VIII (CA8), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210228 protein sequence
Red=Cloning site Green=Tags(s) MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL SDRVIRAAFQ TRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 32.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004047 |
Locus ID | 767 |
UniProt ID | P35219 |
Refseq Size | 2278 |
Cytogenetics | 8q12.1 |
Refseq ORF | 870 |
Synonyms | CA-RP; CA-VIII; CALS; CAMRQ3; CARP |
Summary | The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418248 | CA8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418248 | Transient overexpression lysate of carbonic anhydrase VIII (CA8) |
CNY 3,080.00 |
|
PH310228 | CA8 MS Standard C13 and N15-labeled recombinant protein (NP_004047) |
CNY 19,520.00 |
|
TP720093 | Purified recombinant protein of Homo sapiens carbonic anhydrase VIII (CA8) |
CNY 3,140.00 |