Serotonin transporter (SLC6A4) (NM_001045) Human Recombinant Protein
CAT#: TP310187
Purified recombinant protein of Homo sapiens solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 (SLC6A4), 20 µg
View other "Serotonin transporter" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210187 representing NM_001045
Red=Cloning site Green=Tags(s) METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTL VAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALG QYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCT NYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKV VWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASY NKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVK LLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSP PQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | WB standard (PMID: 26297601) |
Reference Data | |
RefSeq | NP_001036 |
Locus ID | 6532 |
UniProt ID | P31645, B2R7Y7 |
Refseq Size | 2756 |
Cytogenetics | 17q11.2 |
Refseq ORF | 1890 |
Synonyms | 5-HTT; 5-HTTLPR; 5HTT; hSERT; HTT; OCD1; SERT; SERT1 |
Summary | This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression. [provided by RefSeq, May 2019] |
Protein Families | Druggable Genome, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Low-level repeated exposure to diazinon and chlorpyrifos decrease anxiety-like behaviour in adult male rats as assessed by marble burying behaviour
,Savy, CY;Fitchett, AE;McQuade, R;Gartside, SE;Morris, CM;Blain, PG;Judge, SJ;,
Neurotoxicology
,PubMed ID 26297601
[SLC6A4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400427 | SLC6A4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400427 | Transient overexpression lysate of solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 (SLC6A4) |
CNY 3,080.00 |
|
PH310187 | SLC6A4 MS Standard C13 and N15-labeled recombinant protein (NP_001036) |
CNY 14,250.00 |
其它Serotonin transporter产品