PAEP (NM_002571) Human Recombinant Protein
CAT#: TP310121
Recombinant protein of human progestagen-associated endometrial protein (PAEP), transcript variant 2, 20 µg
View other "PAEP" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210121 protein sequence
Red=Cloning site Green=Tags(s) MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPED NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYL ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002562 |
Locus ID | 5047 |
UniProt ID | P09466 |
Refseq Size | 828 |
Cytogenetics | 9q34.3 |
Refseq ORF | 540 |
Synonyms | GD; GdA; GdF; GdS; PAEG; PEP; PP14; ZIF-1 |
Summary | This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419242 | PAEP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422704 | PAEP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419242 | Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 2 |
CNY 3,080.00 |
|
LY422704 | Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 1 |
CNY 3,080.00 |
|
PH310121 | PAEP MS Standard C13 and N15-labeled recombinant protein (NP_002562) |
CNY 19,520.00 |