PAEP (NM_002571) Human Mass Spec Standard
CAT#: PH310121
PAEP MS Standard C13 and N15-labeled recombinant protein (NP_002562)
View other "PAEP" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PAEP MS Standard C13 and N15-labeled recombinant protein (NP_002562) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210121 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC210121 protein sequence
Red=Cloning site Green=Tags(s) MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPED NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYL ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002562 |
RefSeq Size | 828 |
RefSeq ORF | 540 |
Synonyms | GD; GdA; GdF; GdS; PAEG; PEP; PP14; ZIF-1 |
Locus ID | 5047 |
Cytogenetics | 9q34.3 |
Summary | This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419242 | PAEP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422704 | PAEP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419242 | Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 2 |
CNY 3,080.00 |
|
LY422704 | Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 1 |
CNY 3,080.00 |
|
TP310121 | Recombinant protein of human progestagen-associated endometrial protein (PAEP), transcript variant 2, 20 µg |
CNY 2,900.00 |