Galectin 7 (LGALS7) (NM_002307) Human Recombinant Protein
CAT#: TP310052
Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 7 (LGALS7), 20 µg
View other "Galectin 7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210052 representing NM_002307
Red=Cloning site Green=Tags(s) MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002298 |
Locus ID | 3963 |
UniProt ID | P47929 |
Refseq Size | 498 |
Cytogenetics | 19q13.2 |
Refseq ORF | 408 |
Synonyms | GAL7; LGALS7A |
Summary | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419405 | LGALS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419405 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 7 (LGALS7) |
CN¥ 3,080.00 |
|
PH310052 | LGALS7 MS Standard C13 and N15-labeled recombinant protein (NP_002298) |
CN¥ 14,250.00 |
其它Galectin 7产品