S100A12 (NM_005621) Human Recombinant Protein
CAT#: TP310002
Recombinant protein of human S100 calcium binding protein A12 (S100A12), 20 µg
View other "S100A12" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210002 protein sequence
Red=Cloning site Green=Tags(s) MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD FQEFISLVAIALKAAHYHTHKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005612 |
Locus ID | 6283 |
UniProt ID | P80511 |
Refseq Size | 466 |
Cytogenetics | 1q21.3 |
Refseq ORF | 276 |
Synonyms | CAAF1; CAGC; CGRP; ENRAGE; MRP-6; MRP6; p6 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. [provided by RefSeq, Nov 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401723 | S100A12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401723 | Transient overexpression lysate of S100 calcium binding protein A12 (S100A12) |
CNY 3,080.00 |
|
PH310002 | S100A12 MS Standard C13 and N15-labeled recombinant protein (NP_005612) |
CNY 19,520.00 |
其它S100A12产品