Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein
CAT#: TP309976
Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6), 20 µg
View other "Proteasome subunit alpha type 6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209976 protein sequence
Red=Cloning site Green=Tags(s) MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLF KITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIL IGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDF KPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002782 |
Locus ID | 5687 |
UniProt ID | P60900 |
Refseq Size | 1091 |
Cytogenetics | 14q13.2 |
Refseq ORF | 738 |
Synonyms | IOTA; p27K; PROS27 |
Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, Protease, Stem cell - Pluripotency |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419119 | PSMA6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419119 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6) |
CNY 3,080.00 |
|
PH309976 | PSMA6 MS Standard C13 and N15-labeled recombinant protein (NP_002782) |
CNY 19,520.00 |
其它Proteasome subunit alpha type 6产品