NUP50 (NM_007172) Human Recombinant Protein
CAT#: TP309975
Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 2, 20 µg
View other "NUP50" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209975 protein sequence
Red=Cloning site Green=Tags(s) MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGG GRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQP SSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSES ESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSS VLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVT EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009103 |
Locus ID | 10762 |
UniProt ID | Q9UKX7, A0A024R4X7 |
Refseq Size | 5225 |
Cytogenetics | 22q13.31 |
Refseq ORF | 1404 |
Synonyms | NPAP60; NPAP60L |
Summary | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A naturally-monomeric infrared fluorescent protein for protein labeling in vivo
,null,
Nature methods
,PubMed ID 26098020
[NUP50]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407000 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416145 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407000 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 3 |
CNY 3,080.00 |
|
LY416145 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 2 |
CNY 3,080.00 |
|
PH307001 | NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_705931) |
CNY 19,520.00 |
|
PH309975 | NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_009103) |
CNY 19,520.00 |
|
TP307001 | Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 3, 20 µg |
CNY 2,900.00 |