United States
Germany
Japan
United Kingdom
China
14-3-3 zeta (YWHAZ) (NM_003406) Human Recombinant Protein
CAT＃: TP309909
Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1, 20 µg
View other "14-3-3 zeta" proteins (23)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209909 representing NM_003406
Red=Cloning site Green=Tags(s) MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003397 |
| Locus ID | 7534 |
| UniProt ID | P63104 |
| Refseq Size | 2834 |
| Cytogenetics | 8q22.3 |
| Refseq ORF | 735 |
| Synonyms | 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD |
| Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008] |
| Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401160 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407895 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427673 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427674 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427675 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427676 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430139 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401160 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1 |
CNY 3,080.00 |
|
| LY407895 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 |
CNY 3,080.00 |
|
| LY427673 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3 |
CNY 3,080.00 |
|
| LY427674 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4 |
CNY 3,080.00 |
|
| LY427675 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5 |
CNY 3,080.00 |
|
| LY427676 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6 |
CNY 3,080.00 |
|
| LY430139 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 |
CNY 3,080.00 |
|
| PH309909 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_003397) |
CNY 19,520.00 |
|
| PH326946 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129171) |
CNY 14,250.00 |
|
| PH326999 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129172) |
CNY 14,250.00 |
|
| PH327007 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129173) |
CNY 14,250.00 |
|
| PH327049 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129174) |
CNY 14,250.00 |
|
| TP326946 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP326999 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP327007 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP327049 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6, 20 µg |
CNY 2,900.00 |
其它14-3-3 zeta产品
