FAM53A (NM_001013622) Human Recombinant Protein
CAT#: TP309892
Recombinant protein of human family with sequence similarity 53, member A (FAM53A), 20 µg
View other "FAM53A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209892 protein sequence
Red=Cloning site Green=Tags(s) MVTLITEKLQSQSLDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVRSQAATGPDFS FLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSESTGSSTAPPTKRHCRSLSEPEELVRCRSPWRPG SSKVWTPVSKRRCDSGGSATRQGSPGAVLPRSAVWSTGPTSPATPRPSSASGGFVDSSEGSAGSGPLWCS AESCLPSTRRRPSLSQERLAGAGTPLPWASSSPTSTPALGGRRGLLRCRSQPCVLSGKRSRRKRRREEDA RWTRPSLDFLKMTQTLKNSKSLCSLNYEDDDEDDTPVKTVLSSPCDSRGLPGITMPGCSQRGLRTSPVHP NLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001013644 |
Locus ID | 152877 |
UniProt ID | Q6NSI3 |
Refseq Size | 2807 |
Cytogenetics | 4p16.3 |
Refseq ORF | 1194 |
Synonyms | DNTNP |
Summary | May play an important role in neural development; the dorsomedial roof of the third ventricle.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422985 | FAM53A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432997 | FAM53A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422985 | Transient overexpression lysate of family with sequence similarity 53, member A (FAM53A) |
CNY 3,080.00 |
|
LY432997 | Transient overexpression lysate of family with sequence similarity 53, member A (FAM53A), transcript variant 2 |
CNY 3,080.00 |
|
PH309892 | FAM53A MS Standard C13 and N15-labeled recombinant protein (NP_001013644) |
CNY 19,520.00 |