EEF1B2 (NM_001037663) Human Recombinant Protein
CAT#: TP309768
Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3, 20 µg
View other "EEF1B2" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209768 protein sequence
Red=Cloning site Green=Tags(s) MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF EDYVQSMDVAAFNKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032752 |
Locus ID | 1933 |
UniProt ID | P24534 |
Refseq Size | 900 |
Cytogenetics | 2q33.3 |
Refseq ORF | 675 |
Synonyms | EEF1B; EEF1B1; EF1B |
Summary | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400721 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412075 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421974 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400721 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1 |
CNY 3,080.00 |
|
LY412075 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2 |
CNY 3,080.00 |
|
LY421974 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3 |
CNY 3,080.00 |
|
PH300733 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944) |
CNY 19,520.00 |
|
PH309768 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001032752) |
CNY 19,520.00 |
|
PH321264 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001950) |
CNY 19,520.00 |
|
TP300733 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP321264 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 20 µg |
CNY 2,900.00 |