MASA (ENOPH1) (NM_021204) Human Recombinant Protein
CAT#: TP309510
Recombinant protein of human enolase-phosphatase 1 (ENOPH1), 20 µg
View other "MASA" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209510 protein sequence
Red=Cloning site Green=Tags(s) MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVR KWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFL TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067027 |
Locus ID | 58478 |
UniProt ID | Q9UHY7 |
Refseq Size | 2191 |
Cytogenetics | 4q21.22 |
Refseq ORF | 783 |
Synonyms | E1; MASA; MST145; mtnC |
Summary | Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Cysteine and methionine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412010 | ENOPH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412010 | Transient overexpression lysate of enolase-phosphatase 1 (ENOPH1) |
CNY 3,080.00 |
|
PH309510 | ENOPH1 MS Standard C13 and N15-labeled recombinant protein (NP_067027) |
CNY 19,520.00 |