LMAN2L (NM_030805) Human Recombinant Protein
CAT#: TP309496
Recombinant protein of human lectin, mannose-binding 2-like (LMAN2L), transcript variant 2, 20 µg
View other "LMAN2L" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209496 protein sequence
Red=Cloning site Green=Tags(s) MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSS LWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQ PGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYD TFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTP EEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_110432 |
Locus ID | 81562 |
UniProt ID | Q9H0V9 |
Refseq Size | 2425 |
Cytogenetics | 2q11.2 |
Refseq ORF | 1044 |
Synonyms | MRT52; VIPL |
Summary | This gene encodes a protein belonging to the L-type lectin group of type 1 membrane proteins, which function in the mammalian early secretory pathway. These proteins contain luminal carbohydrate recognition domains, which display homology to leguminous lectins. Unlike other proteins of the group, which cycle in the early secretory pathway and are predominantly associated with post endoplasmic reticulum membranes, the protein encoded by this gene is a non-cycling resident protein of the ER, where it functions as a cargo receptor for glycoproteins. It is proposed to regulate exchange of folded proteins for transport to the Golgi and exchange of misfolded glycoproteins for transport to the ubiquitin-proteasome pathway. [provided by RefSeq, Apr 2016] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410700 | LMAN2L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428015 | LMAN2L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410700 | Transient overexpression lysate of lectin, mannose-binding 2-like (LMAN2L), transcript variant 2 |
CNY 3,080.00 |
|
LY428015 | Transient overexpression lysate of lectin, mannose-binding 2-like (LMAN2L), transcript variant 1 |
CNY 3,080.00 |
|
PH309496 | LMAN2L MS Standard C13 and N15-labeled recombinant protein (NP_110432) |
CNY 19,520.00 |