LMAN2L (NM_030805) Human Mass Spec Standard
CAT#: PH309496
LMAN2L MS Standard C13 and N15-labeled recombinant protein (NP_110432)
View other "LMAN2L" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LMAN2L MS Standard C13 and N15-labeled recombinant protein (NP_110432) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209496 |
Predicted MW | 39.7 kDa |
Protein Sequence |
>RC209496 protein sequence
Red=Cloning site Green=Tags(s) MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSS LWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQ PGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYD TFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTP EEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_110432 |
RefSeq Size | 2425 |
RefSeq ORF | 1044 |
Synonyms | MRT52; VIPL |
Locus ID | 81562 |
Cytogenetics | 2q11.2 |
Summary | This gene encodes a protein belonging to the L-type lectin group of type 1 membrane proteins, which function in the mammalian early secretory pathway. These proteins contain luminal carbohydrate recognition domains, which display homology to leguminous lectins. Unlike other proteins of the group, which cycle in the early secretory pathway and are predominantly associated with post endoplasmic reticulum membranes, the protein encoded by this gene is a non-cycling resident protein of the ER, where it functions as a cargo receptor for glycoproteins. It is proposed to regulate exchange of folded proteins for transport to the Golgi and exchange of misfolded glycoproteins for transport to the ubiquitin-proteasome pathway. [provided by RefSeq, Apr 2016] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410700 | LMAN2L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428015 | LMAN2L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410700 | Transient overexpression lysate of lectin, mannose-binding 2-like (LMAN2L), transcript variant 2 |
CNY 3,080.00 |
|
LY428015 | Transient overexpression lysate of lectin, mannose-binding 2-like (LMAN2L), transcript variant 1 |
CNY 3,080.00 |
|
TP309496 | Recombinant protein of human lectin, mannose-binding 2-like (LMAN2L), transcript variant 2, 20 µg |
CNY 2,900.00 |