United States
Germany
Japan
United Kingdom
China
PPM1B (NM_177969) Human Recombinant Protein
CAT＃: TP309425
Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 3, 20 µg
View other "PPM1B" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209425 protein sequence
Red=Cloning site Green=Tags(s) MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_808908 |
| Locus ID | 5495 |
| UniProt ID | O75688 |
| Refseq Size | 1829 |
| Cytogenetics | 2p21 |
| Refseq ORF | 1440 |
| Synonyms | PP2C-beta; PP2C-beta-X; PP2CB; PP2CBETA; PPC2BETAX |
| Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
| Protein Pathways | MAPK signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
WIP1 Phosphatase as a Potential Therapeutic Target in Neuroblastoma
,null,
PLoS ONE
,PubMed ID 25658463
[PPM1B]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406063 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419156 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422387 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406063 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2 |
CNY 3,080.00 |
|
| LY419156 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1 |
CNY 4,840.00 |
|
| LY422387 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 4 |
CNY 3,080.00 |
|
| PH309425 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808908) |
CNY 19,520.00 |
|
| PH312918 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_002697) |
CNY 19,520.00 |
|
| PH322782 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808907) |
CNY 19,520.00 |
|
| TP312918 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP322782 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2, 20 µg |
CNY 2,900.00 |
