IPMK (NM_152230) Human Recombinant Protein
CAT#: TP309343
Recombinant protein of human inositol polyphosphate multikinase (IPMK), 20 µg
View other "IPMK" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209343 protein sequence
Red=Cloning site Green=Tags(s) MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGKDKVGILQHPD GTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKP CIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSDSYETENQHYGRSLTKETIKDG VSRFFHNGYCLRKDAVAASIQKIEKILQWFENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSK GQLSDTEVLEYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMS QEHLNGNVLSQLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689416 |
Locus ID | 253430 |
UniProt ID | Q8NFU5 |
Refseq Size | 6133 |
Cytogenetics | 10q21.1 |
Refseq ORF | 1248 |
Summary | This gene encodes a member of the inositol phosphokinase family. The encoded protein has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates. The encoded protein plays an important role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate, and has a preferred 5-kinase activity. This gene may play a role in nuclear mRNA export. Pseudogenes of this gene are located on the long arm of chromosome 13 and the short arm of chromosome 19. [provided by RefSeq, Dec 2010] |
Protein Pathways | Inositol phosphate metabolism |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Identification of Small-Molecule Inhibitors of Human Inositol Hexakisphosphate Kinases by High-Throughput Screening
,Liao, G;Ye, W;Heitmann, T;Ernst, G;DePasquale, M;Xu, L;Wormald, M;Hu, X;Ferrer, M;Harmel, R;Fiedler, D;Barrow, J;Wei, H;,
ACS Pharmacology & Translational Science
,PubMed ID 33860201
[IPMK]
|
IPMK Mediates Activation of ULK Signaling and Transcriptional Regulation of Autophagy Linked to Liver Inflammation and Regeneration
,Guha, P;Tyagi, R;Chowdhury, S;Reilly, L;Fu, C;Xu, R;Resnick, A;Snyder, S;,
Cell Reports
,PubMed ID 30840891
[IPMK]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407707 | IPMK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407707 | Transient overexpression lysate of inositol polyphosphate multikinase (IPMK) |
CNY 3,080.00 |
|
PH309343 | IPMK MS Standard C13 and N15-labeled recombinant protein (NP_689416) |
CNY 19,520.00 |