FAM3B (NM_058186) Human Recombinant Protein
CAT#: TP309309
Recombinant protein of human family with sequence similarity 3, member B (FAM3B), transcript variant 1, 20 µg
View other "FAM3B" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209309 protein sequence
Red=Cloning site Green=Tags(s) MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS DAKNNRYSGWPAEIQIEGCIPKERS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_478066 |
Locus ID | 54097 |
UniProt ID | P58499 |
Refseq Size | 1384 |
Cytogenetics | 21q22.3 |
Refseq ORF | 705 |
Synonyms | 2-21; C21orf11; C21orf76; ORF9; PANDER; PRED44 |
Summary | Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403301 | FAM3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403719 | FAM3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403301 | Transient overexpression lysate of family with sequence similarity 3, member B (FAM3B), transcript variant 1 |
CNY 3,080.00 |
|
LY403719 | Transient overexpression lysate of family with sequence similarity 3, member B (FAM3B), transcript variant 2 |
CNY 3,080.00 |
|
PH309309 | FAM3B MS Standard C13 and N15-labeled recombinant protein (NP_478066) |
CNY 19,520.00 |