CNOT7 (NM_013354) Human Recombinant Protein
CAT#: TP309293
Recombinant protein of human CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 1, 20 µg
View other "CNOT7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209293 protein sequence
Red=Cloning site Green=Tags(s) MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE ANKQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037486 |
Locus ID | 29883 |
UniProt ID | Q9UIV1 |
Refseq Size | 2646 |
Cytogenetics | 8p22 |
Refseq ORF | 855 |
Synonyms | CAF-1; CAF1; Caf1a; hCAF-1 |
Summary | The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Apr 2016] |
Protein Families | Transcription Factors |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409310 | CNOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415657 | CNOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409310 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 2 |
CNY 3,080.00 |
|
LY415657 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 1 |
CNY 3,080.00 |
|
PH309293 | CNOT7 MS Standard C13 and N15-labeled recombinant protein (NP_037486) |
CNY 19,520.00 |