SSPN (NM_005086) Human Recombinant Protein
CAT#: TP309123
Recombinant protein of human sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1, 20 µg
View other "SSPN" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209123 protein sequence
Red=Cloning site Green=Tags(s) MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005077 |
Locus ID | 8082 |
UniProt ID | Q14714 |
Refseq Size | 4547 |
Cytogenetics | 12p12.1 |
Refseq ORF | 729 |
Synonyms | DAGA5; KRAG; NSPN; SPN1; SPN2 |
Summary | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417535 | SSPN HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY417535 | Transient overexpression lysate of sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1 |
CN¥ 3,080.00 |
|
PH309123 | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077) |
CN¥ 19,520.00 |
|
PH327888 | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_001129295) |
CN¥ 14,250.00 |
|
TP327888 | Purified recombinant protein of Homo sapiens sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 2, 20 µg |
CN¥ 2,900.00 |