LAP3 (NM_015907) Human Recombinant Protein
CAT#: TP309052
Recombinant protein of human leucine aminopeptidase 3 (LAP3), 20 µg
View other "LAP3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209052 protein sequence
Red=Cloning site Green=Tags(s) MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD EVPYLRKGMTGRPTRTLIEFLLRFSQDNA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | LAP3 activity verified in a biochemical assay: Leucine aminopeptidase 3 (LAP3, TP309052) activity was measured in a fluorescent biochemical assay. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides and is most active on leucine. LAP3 activity was measured in a 100 µl reaction mixture containing 1 mM L-leucine 7-amido-4-methyl coumarin (Leu-AMC), 50 mM Tris, pH 8.0, 4 mM MgCl2, and 1 mM MnCl2. Cleavage of leucine from the AMC moiety results in a strong increase in fluorescence intensity. Fluorescence was measured over time with an excitation wavelength of 380 nm and an emission wavelength of 460 nm. The activity of the enzyme in this system remained constant over six hours. |
Reference Data | |
RefSeq | NP_056991 |
Locus ID | 51056 |
UniProt ID | P28838 |
Refseq Size | 2100 |
Cytogenetics | 4p15.32 |
Refseq ORF | 1557 |
Synonyms | HEL-S-106; LAP; LAPEP; PEPS |
Summary | Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Aminopeptidase Expression in Multiple Myeloma Associates with Disease Progression and Sensitivity to Melflufen
,null,
Cancers
,PubMed ID 33810334
[LAP3]
|
A computational method for detection of ligand-binding proteins from dose range thermal proteome profiles
,null,
Nature Communications
,PubMed ID 33188197
[LAP3]
|
Computational analysis of ligand dose range thermal proteome profiles
,Kurzawa, N;Becher, I;Sridharan, S;Franken, H;,
bioRxiv
[LAP3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402470 | LAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402470 | Transient overexpression lysate of leucine aminopeptidase 3 (LAP3) |
CNY 3,080.00 |
|
PH309052 | LAP3 MS Standard C13 and N15-labeled recombinant protein (NP_056991) |
CNY 19,520.00 |