United States
Germany
Japan
United Kingdom
China
Host cell factor C1 regulator 1 (HCFC1R1) (NM_017885) Human Recombinant Protein
CAT＃: TP309047
Recombinant protein of human host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 1, 20 µg
View other "Host cell factor C1 regulator 1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209047 protein sequence
Red=Cloning site Green=Tags(s) MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQ LSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060355 |
| Locus ID | 54985 |
| UniProt ID | Q9NWW0 |
| Refseq Size | 1023 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 414 |
| Synonyms | HPIP |
| Summary | Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413468 | HCFC1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424320 | HCFC1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424321 | HCFC1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413468 | Transient overexpression lysate of host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 1 |
CNY 3,080.00 |
|
| LY424320 | Transient overexpression lysate of host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 2 |
CNY 3,080.00 |
|
| LY424321 | Transient overexpression lysate of host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 3 |
CNY 3,080.00 |
|
| PH309047 | HCFC1R1 MS Standard C13 and N15-labeled recombinant protein (NP_060355) |
CNY 19,520.00 |
|
| TP760844 | Purified recombinant protein of Human host cell factor C1 regulator 1 (XPO1 dependent) (HCFC1R1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Host cell factor C1 regulator 1产品
