Estrogen Related Receptor alpha (ESRRA) (NM_004451) Human Recombinant Protein
CAT#: TP309028
Purified recombinant protein of Homo sapiens estrogen-related receptor alpha (ESRRA), 20 µg
View other "Estrogen Related Receptor alpha" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209028 representing NM_004451
Red=Cloning site Green=Tags(s) MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLV LSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCL RVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLY AMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPL QDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA MMD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004442 |
Locus ID | 2101 |
UniProt ID | P11474, Q569H8 |
Refseq Size | 2284 |
Cytogenetics | 11q13.1 |
Refseq ORF | 1269 |
Synonyms | ERR1; ERRa; ERRalpha; ESRL1; NR3B1 |
Summary | The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1. [provided by RefSeq, Jun 2019] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417978 | ESRRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417978 | Transient overexpression lysate of estrogen-related receptor alpha (ESRRA) |
CNY 3,080.00 |
|
PH309028 | ESRRA MS Standard C13 and N15-labeled recombinant protein (NP_004442) |
CNY 14,250.00 |
其它Estrogen Related Receptor alpha产品