CD146 (MCAM) (NM_006500) Human Recombinant Protein
CAT#: TP308937
Recombinant protein of human melanoma cell adhesion molecule (MCAM), 20 µg
View other "CD146" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208937 representing NM_006500
Red=Cloning site Green=Tags(s) MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKR TLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPN IQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKA QLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTP ELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD KRAPGDQGEKYIDLRH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006491 |
Locus ID | 4162 |
UniProt ID | P43121, A0A024R3I5 |
Refseq Size | 3332 |
Cytogenetics | 11q23.3 |
Refseq ORF | 1938 |
Synonyms | CD146; HEMCAM; MelCAM; METCAM; MUC18 |
Summary | Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Characterization of novel neutralizing mouse monoclonal antibody JM1-24-3 developed against MUC18 in metastatic melanoma
,Feng, R;Wang, Y;Ramachandran, V;Ma, Q;May, MM;Li, M;Zhou, JX;Xu, X;Xu, K;Fang, S;Xia, W;Sui, D;Liu, H;Gao, X;Prieto, V;Blacklow, SC;Lu, M;Lee, JE;,
Journal of experimental & clinical cancer research : CR
,PubMed ID 33278894
[MCAM]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416601 | MCAM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416601 | Transient overexpression lysate of melanoma cell adhesion molecule (MCAM) |
CNY 3,080.00 |
|
PH308937 | MCAM MS Standard C13 and N15-labeled recombinant protein (NP_006491) |
CNY 19,520.00 |