FXYD4 (NM_173160) Human Recombinant Protein
CAT#: TP308892
Recombinant protein of human FXYD domain containing ion transport regulator 4 (FXYD4), 20 µg
View other "FXYD4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208892 protein sequence
Red=Cloning site Green=Tags(s) MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH SPVPEKAIPLITPGSATTC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775183 |
Locus ID | 53828 |
UniProt ID | P59646 |
Refseq Size | 787 |
Cytogenetics | 10q11.21 |
Refseq ORF | 267 |
Synonyms | CHIF |
Summary | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.[provided by RefSeq, May 2010] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406692 | FXYD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY406692 | Transient overexpression lysate of FXYD domain containing ion transport regulator 4 (FXYD4) |
CN¥ 3,080.00 |
|
PH308892 | FXYD4 MS Standard C13 and N15-labeled recombinant protein (NP_775183) |
CN¥ 19,520.00 |