DDX1 (NM_004939) Human Recombinant Protein
CAT#: TP308769
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 (DDX1), 20 µg
View other "DDX1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208769 protein sequence
Red=Cloning site Green=Tags(s) MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKD QQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCH DQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGK DLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQT KFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRL DDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIK ILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHV CSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGS YKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 82.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Biolayer interferometry (BLI) assay (PMID: 25496916) |
Reference Data | |
RefSeq | NP_004930 |
Locus ID | 1653 |
UniProt ID | Q92499, A3RJH1 |
Refseq Size | 2755 |
Cytogenetics | 2p24.3 |
Refseq ORF | 2220 |
Synonyms | DBP-RB; UKVH5d |
Summary | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Chemical profiling of DNA G-quadruplex-interacting proteins in live cells
,null,
Nature Chemistry
,PubMed ID 34183817
[DDX1]
|
A HIV-1 Tat mutant protein disrupts HIV-1 Rev function by targeting the DEAD-box RNA helicase DDX1
,Lin, MH;Sivakumaran, H;Jones, A;Li, D;Harper, C;Wei, T;Jin, H;Rustanti, L;Meunier, FA;Spann, K;Harrich, D;,
Retrovirology
,PubMed ID 25496916
[DDX1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417641 | DDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417641 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 (DDX1) |
CNY 3,080.00 |
|
PH308769 | DDX1 MS Standard C13 and N15-labeled recombinant protein (NP_004930) |
CNY 19,520.00 |