Ribonuclease T2 (RNASET2) (NM_003730) Human Recombinant Protein
CAT#: TP308746
Recombinant protein of human ribonuclease T2 (RNASET2), 20 µg
View other "Ribonuclease T2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208746 protein sequence
Red=Cloning site Green=Tags(s) MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003721 |
Locus ID | 8635 |
UniProt ID | O00584 |
Refseq Size | 1250 |
Cytogenetics | 6q27 |
Refseq ORF | 768 |
Synonyms | bA514O12.3; RNASE6PL |
Summary | This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Rnaset2 inhibits melanocyte outgrowth possibly through interacting with shootin1.
,null,
Journal of dermatological science
,PubMed ID 26293343
[RNASET2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418470 | RNASET2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418470 | Transient overexpression lysate of ribonuclease T2 (RNASET2) |
CN¥ 3,080.00 |
|
PH308746 | RNASET2 MS Standard C13 and N15-labeled recombinant protein (NP_003721) |
CN¥ 19,520.00 |
其它Ribonuclease T2产品