C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein
CAT#: TP308732
Recombinant protein of human chromosome 20 open reading frame 103 (C20orf103), 20 µg
View other "C20orf103" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208732 protein sequence
Red=Cloning site Green=Tags(s) MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPY DVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSK VQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQP FDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036393 |
Locus ID | 24141 |
UniProt ID | Q9UJQ1 |
Refseq Size | 2059 |
Cytogenetics | 20p12.2 |
Refseq ORF | 840 |
Synonyms | BAD-LAMP; BADLAMP; C20orf103; LAMP-5; UNC-46 |
Summary | Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415874 | LAMP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415874 | Transient overexpression lysate of chromosome 20 open reading frame 103 (C20orf103) |
CNY 3,080.00 |
|
PH308732 | C20orf103 MS Standard C13 and N15-labeled recombinant protein (NP_036393) |
CNY 19,520.00 |
其它C20orf103产品