United States
Germany
Japan
United Kingdom
China
MTMR2 (NM_016156) Human Recombinant Protein
CAT＃: TP308703
Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 1, 20 µg
View other "MTMR2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208703 protein sequence
Red=Cloning site Green=Tags(s) METSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKL AEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGG ASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGWKLYD PLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQAT ITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVF LDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQM TRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYS NHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERAS SPAQCVTPVQTVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 73.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057240 |
| Locus ID | 8898 |
| UniProt ID | Q13614 |
| Refseq Size | 4603 |
| Cytogenetics | 11q21 |
| Refseq ORF | 1929 |
| Synonyms | CMT4B; CMT4B1 |
| Summary | This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Phosphatase |
| Protein Pathways | Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404513 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414151 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430848 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404513 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 3 |
CNY 3,080.00 |
|
| LY414151 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 1 |
CNY 3,080.00 |
|
| PH308703 | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_057240) |
CNY 19,520.00 |
|
| PH314811 | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_958438) |
CNY 19,520.00 |
|
| TP314811 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP324099 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 2, 20 µg |
CNY 2,900.00 |
