HINT2 (NM_032593) Human Recombinant Protein
CAT#: TP308371
Recombinant protein of human histidine triad nucleotide binding protein 2 (HINT2), 20 µg
View other "HINT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208371 protein sequence
Red=Cloning site Green=Tags(s) MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILY EDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKL GAQSVYHLHIHVLGGRQLQWPPG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115982 |
Locus ID | 84681 |
UniProt ID | Q9BX68 |
Refseq Size | 652 |
Cytogenetics | 9p13.3 |
Refseq ORF | 489 |
Synonyms | HIT-17 |
Summary | Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403175 | HINT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403175 | Transient overexpression lysate of histidine triad nucleotide binding protein 2 (HINT2), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH308371 | HINT2 MS Standard C13 and N15-labeled recombinant protein (NP_115982) |
CNY 19,520.00 |