DGCR6 (NM_005675) Human Recombinant Protein
CAT#: TP308368
Purified recombinant protein of Homo sapiens DiGeorge syndrome critical region gene 6 (DGCR6), 20 µg
View other "DGCR6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208368 representing NM_005675
Red=Cloning site Green=Tags(s) MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQK IVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQ CDQKGSPVPP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005666 |
Locus ID | 8214 |
UniProt ID | Q14129 |
Refseq Size | 1188 |
Cytogenetics | 22q11 |
Refseq ORF | 660 |
Summary | DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417144 | DGCR6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417144 | Transient overexpression lysate of DiGeorge syndrome critical region gene 6 (DGCR6) |
CNY 3,080.00 |
|
PH308368 | DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666) |
CNY 14,250.00 |