DGCR6 (NM_005675) Human Mass Spec Standard
CAT#: PH308368
DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666)
View other "DGCR6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208368 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC208368 representing NM_005675
Red=Cloning site Green=Tags(s) MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQK IVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQ CDQKGSPVPP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005666 |
RefSeq Size | 1188 |
RefSeq ORF | 660 |
Locus ID | 8214 |
Cytogenetics | 22q11 |
Summary | DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417144 | DGCR6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417144 | Transient overexpression lysate of DiGeorge syndrome critical region gene 6 (DGCR6) |
CNY 3,080.00 |
|
TP308368 | Purified recombinant protein of Homo sapiens DiGeorge syndrome critical region gene 6 (DGCR6), 20 µg |
CNY 2,900.00 |