NAA40 (NM_024771) Human Recombinant Protein
CAT#: TP308314
Recombinant protein of human N-acetyltransferase 11 (GCN5-related, putative) (NAT11), 20 µg
View other "NAA40" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208314 protein sequence
Red=Cloning site Green=Tags(s) MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATV DWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEV QLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCS YEILSRRTKFGDSHHSHAGGHCGGCCH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079047 |
Locus ID | 79829 |
UniProt ID | Q86UY6, A0A024R5C6 |
Refseq Size | 3681 |
Cytogenetics | 11q13.1 |
Refseq ORF | 711 |
Synonyms | hNatD; NAT11; NatD; PATT1 |
Summary | N-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A (PubMed:21935442, PubMed:25619998). In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the 'Ser-Gly-Arg-Gly sequence' (PubMed:21935442, PubMed:25619998). Acts as a negative regulator of apoptosis (PubMed:26666750). May play a role in hepatic lipid metabolism (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411083 | NAA40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411083 | Transient overexpression lysate of N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40) |
CNY 3,080.00 |
|
PH308314 | NAA40 MS Standard C13 and N15-labeled recombinant protein (NP_079047) |
CNY 19,520.00 |