KCNIP1 (NM_014592) Human Recombinant Protein
CAT#: TP308255
Recombinant protein of human Kv channel interacting protein 1 (KCNIP1), transcript variant 2, 20 µg
View other "KCNIP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208255 protein sequence
Red=Cloning site Green=Tags(s) MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVN EDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDG YINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ LFQNVM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055407 |
Locus ID | 30820 |
UniProt ID | Q9NZI2 |
Refseq Size | 2028 |
Cytogenetics | 5q35.1 |
Refseq ORF | 648 |
Synonyms | KCHIP1; VABP |
Summary | This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415191 | KCNIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415191 | Transient overexpression lysate of Kv channel interacting protein 1 (KCNIP1), transcript variant 2 |
CNY 3,080.00 |
|
PH308255 | KCNIP1 MS Standard C13 and N15-labeled recombinant protein (NP_055407) |
CNY 19,520.00 |