UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein
CAT#: TP307977
Recombinant protein of human ubiquitin-conjugating enzyme E2R 2 (UBE2R2), 20 µg
View other "UBC3B" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207977 representing NM_017811
Red=Cloning site Green=Tags(s) MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPY SPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA NVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDL YDDDIDDEDEEEEDADCYDDDDSGNEES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060281 |
Locus ID | 54926 |
UniProt ID | Q712K3 |
Refseq Size | 4457 |
Cytogenetics | 9p13.3 |
Refseq ORF | 714 |
Synonyms | CDC34B; E2-CDC34B; UBC3B |
Summary | Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413520 | UBE2R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY413520 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2R 2 (UBE2R2) |
CN¥ 3,080.00 |
|
PH307977 | UBE2R2 MS Standard C13 and N15-labeled recombinant protein (NP_060281) |
CN¥ 19,520.00 |
|
TP720963 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2R 2 (UBE2R2) |
CN¥ 1,800.00 |