RIPX (RUFY3) (NM_014961) Human Recombinant Protein
CAT#: TP307961
Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 2, 20 µg
View other "RIPX" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207961 protein sequence
Red=Cloning site Green=Tags(s) MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM NLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLV PEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAG LLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNN LQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLK EETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055776 |
Locus ID | 22902 |
UniProt ID | Q7L099 |
Refseq Size | 4419 |
Cytogenetics | 4q13.3 |
Refseq ORF | 1407 |
Synonyms | RIPX; SINGAR1; ZFYVE30 |
Summary | This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414890 | RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427257 | RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414890 | Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 2 |
CNY 3,080.00 |
|
LY427257 | Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 3 |
CNY 3,080.00 |
|
PH307961 | RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_055776) |
CNY 19,520.00 |
|
PH325870 | RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_001124181) |
CNY 14,250.00 |
|
TP325870 | Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 3, 20 µg |
CNY 2,900.00 |