RIPX (RUFY3) (NM_014961) Human Mass Spec Standard
CAT#: PH307961
RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_055776)
View other "RIPX" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_055776) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207961 |
Predicted MW | 53 kDa |
Protein Sequence |
>RC207961 protein sequence
Red=Cloning site Green=Tags(s) MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM NLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLV PEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAG LLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNN LQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLK EETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055776 |
RefSeq Size | 4419 |
RefSeq ORF | 1407 |
Synonyms | RIPX; SINGAR1; ZFYVE30 |
Locus ID | 22902 |
Cytogenetics | 4q13.3 |
Summary | This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414890 | RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427257 | RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414890 | Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 2 |
CNY 3,080.00 |
|
LY427257 | Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 3 |
CNY 3,080.00 |
|
PH325870 | RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_001124181) |
CNY 14,250.00 |
|
TP307961 | Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325870 | Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 3, 20 µg |
CNY 2,900.00 |