P4HA2 (NM_001017973) Human Recombinant Protein
CAT#: TP307779
Recombinant protein of human prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 2, 20 µg
View other "P4HA2" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207779 protein sequence
Red=Cloning site Green=Tags(s) MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTS KSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQ DTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVL DYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERP VDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEI ERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN YGVGGQYEPHFDFSRRPFDSGLKTEGNRLATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRS GEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGSTEVD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001017973 |
Locus ID | 8974 |
UniProt ID | O15460 |
Refseq Size | 2582 |
Cytogenetics | 5q31.1 |
Refseq ORF | 1599 |
Synonyms | MYP25 |
Summary | This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422630 | P4HA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422631 | P4HA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC428199 | P4HA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY422630 | Transient overexpression lysate of prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY422631 | Transient overexpression lysate of prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 3 |
CN¥ 4,840.00 |
|
LY428199 | Transient overexpression lysate of prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 4 |
CN¥ 3,080.00 |
|
PH307779 | P4HA2 MS Standard C13 and N15-labeled recombinant protein (NP_001017973) |
CN¥ 19,520.00 |
|
TP762642 | Purified recombinant protein of Human prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 4, full length, with N-GST and C-His tag, expressed in E.coli, 50ug |
CN¥ 2,480.00 |