PDE4A (NM_006202) Human Recombinant Protein
CAT#: TP307765
Recombinant protein of human phosphodiesterase 4A, cAMP-specific (phosphodiesterase E2 dunce homolog, Drosophila) (PDE4A), transcript variant 4, 20 µg
View other "PDE4A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207765 representing NM_006202
Red=Cloning site Green=Tags(s) MPLVDFFCETCSKPWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPSPTMKERE KQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTDQEELLAQELENLNKWGLNI FCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLL ATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNC DIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHC ADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWAD LVHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEISMAQIPCT AQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSR EEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLPSTAAEVEAQREHQAAKRACSACAGTFGED TSALPAPGGGGSGGDPT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 72 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Binding assay (PMID: 27148684) |
Reference Data | |
RefSeq | NP_006193 |
Locus ID | 5141 |
UniProt ID | P27815 |
Refseq Size | 4255 |
Cytogenetics | 19p13.2 |
Refseq ORF | 1941 |
Synonyms | DPDE2; PDE4; PDE46 |
Summary | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Resveratrol directly targets DDX5 resulting in suppression of the mTORC1 pathway in prostate cancer
,Taniguchi, T;Iizumi, Y;Watanabe, M;Masuda, M;Morita, M;Aono, Y;Toriyama, S;Oishi, M;Goi, W;Sakai, T;,
Cell Death Dis
,PubMed ID 27148684
[PDE4A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426362 | PDE4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY426362 | Transient overexpression lysate of phosphodiesterase 4A, cAMP-specific (phosphodiesterase E2 dunce homolog, Drosophila) (PDE4A), transcript variant 1 |
CNY 4,840.00 |
|
PH307765 | PDE4A MS Standard C13 and N15-labeled recombinant protein (NP_006193) |
CNY 19,520.00 |