CHMP4B (NM_176812) Human Recombinant Protein
CAT#: TP307637
Recombinant protein of human chromatin modifying protein 4B (CHMP4B), 20 µg
View other "CHMP4B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207637 protein sequence
Red=Cloning site Green=Tags(s) MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALK RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQE LAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEE DDDMKELENWAGSM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_789782 |
Locus ID | 128866 |
UniProt ID | Q9H444 |
Refseq Size | 1664 |
Cytogenetics | 20q11.22 |
Refseq ORF | 672 |
Synonyms | C20orf178; CHMP4A; CTPP3; CTRCT31; dJ553F4.4; Shax1; SNF7; SNF7-2; Vps32-2; VPS32B |
Summary | This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.[provided by RefSeq, Oct 2009] |
Protein Pathways | Endocytosis |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
ADAPT identifies an ESCRT complex composition that discriminates VCaP from LNCaP prostate cancer cell exosomes
,Hornung, T;O'Neill, HA;Logie, SC;Fowler, KM;Duncan, JE;Rosenow, M;Bondre, AS;Tinder, T;Maher, V;Zarkovic, J;Zhong, Z;Richards, MN;Wei, X;Miglarese, MR;Mayer, G;Famulok, M;Spetzler, D;,
Nucleic Acids Res.
,PubMed ID 31989173
[CHMP4B]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406132 | CHMP4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406132 | Transient overexpression lysate of chromatin modifying protein 4B (CHMP4B) |
CNY 3,080.00 |
|
PH307637 | CHMP4B MS Standard C13 and N15-labeled recombinant protein (NP_789782) |
CNY 19,520.00 |