FNDC4 (NM_022823) Human Recombinant Protein
CAT#: TP307471
Recombinant protein of human fibronectin type III domain containing 4 (FNDC4), 20 µg
View other "FNDC4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207471 protein sequence
Red=Cloning site Green=Tags(s) MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP EQSPQGRPVGTRQKKSPSINTIDV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073734 |
Locus ID | 64838 |
UniProt ID | Q9H6D8 |
Refseq Size | 1697 |
Cytogenetics | 2p23.3 |
Refseq ORF | 702 |
Synonyms | FRCP1 |
Summary | Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411537 | FNDC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411537 | Transient overexpression lysate of fibronectin type III domain containing 4 (FNDC4) |
CNY 3,080.00 |
|
PH307471 | FNDC4 MS Standard C13 and N15-labeled recombinant protein (NP_073734) |
CNY 19,520.00 |