UBE2D3 (NM_003340) Human Recombinant Protein
CAT#: TP307371
Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1, 20 µg
View other "UBE2D3" proteins (26)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207371 protein sequence
Red=Cloning site Green=Tags(s) MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE WTQKYAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003331 |
Locus ID | 7323 |
UniProt ID | P61077 |
Refseq Size | 3976 |
Cytogenetics | 4q24 |
Refseq ORF | 441 |
Synonyms | E2(17)KB3; UBC4/5; UBCH5C |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. [provided by RefSeq, Jan 2017] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405574 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405575 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405576 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405577 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405578 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405579 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405581 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418758 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY405574 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2 |
CN¥ 3,080.00 |
|
LY405575 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3 |
CN¥ 3,080.00 |
|
LY405576 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 4 |
CN¥ 3,080.00 |
|
LY405577 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5 |
CN¥ 3,080.00 |
|
LY405578 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 6 |
CN¥ 3,080.00 |
|
LY405579 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 7 |
CN¥ 3,080.00 |
|
LY405581 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9 |
CN¥ 3,080.00 |
|
LY418758 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1 |
CN¥ 3,080.00 |
|
PH307371 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_003331) |
CN¥ 19,520.00 |
|
PH313585 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871615) |
CN¥ 14,250.00 |
|
PH313686 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871618) |
CN¥ 14,250.00 |
|
PH315841 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616) |
CN¥ 19,520.00 |
|
PH318977 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871622) |
CN¥ 19,520.00 |
|
TP313585 | Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP313686 | Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5, 20 µg |
CN¥ 2,900.00 |
|
TP315841 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP318977 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9, 20 µg |
CN¥ 2,900.00 |
|
TP721151 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 |
CN¥ 1,800.00 |