PARN (NM_002582) Human Recombinant Protein
CAT#: TP307220
Recombinant protein of human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, 20 µg
View other "PARN" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207220 protein sequence
Red=Cloning site Green=Tags(s) MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFG LCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEER QLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQR KLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANS GKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRL KETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFN KLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQ VKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTA PSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPA TLFEVPDTW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 73.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002573 |
Locus ID | 5073 |
UniProt ID | O95453 |
Refseq Size | 3083 |
Cytogenetics | 16p13.12 |
Refseq ORF | 1917 |
Synonyms | DAN; DKCB6; PFBMFT4 |
Summary | The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
Protein Families | Transcription Factors |
Protein Pathways | RNA degradation |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
The H/ACA complex disrupts triplex in hTR precursor to permit processing by RRP6 and PARN
,Tseng, CK;Wang, HF;Schroeder, MR;Baumann, P;,
Nat Commun
,PubMed ID 30575725
[PARN]
|
A feedback mechanism between PLD and deadenylase PARN for the shortening of eukaryotic poly(A) mRNA tails that is deregulated in cancer cells
,null,
Biology Open
,PubMed ID 28011629
[PARN]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419233 | PARN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419233 | Transient overexpression lysate of poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1 |
CNY 3,080.00 |
|
PH307220 | PARN MS Standard C13 and N15-labeled recombinant protein (NP_002573) |
CNY 19,520.00 |