YTHDF1 (NM_017798) Human Recombinant Protein
CAT#: TP307185
Recombinant protein of human YTH domain family, member 1 (YTHDF1), 20 µg
View other "YTHDF1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207185 protein sequence
Red=Cloning site Green=Tags(s) MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSL NEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ QTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSV ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPV PKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNS PGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLR HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060268 |
Locus ID | 54915 |
UniProt ID | Q9BYJ9 |
Refseq Size | 3277 |
Cytogenetics | 20q13.33 |
Refseq ORF | 1677 |
Synonyms | C20orf21 |
Summary | Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency (PubMed:24284625, PubMed:26046440, PubMed:26318451). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability (PubMed:24284625). Acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation (PubMed:26046440). Required to facilitate learning and memory formation in the hippocampus by enhancing protein synthesis upon neuronal stimulation: in response to neuronal stimulation, binds to m6A-containing neuronal mRNAs, promoting their translation, thereby contributing to learning and memory (By similarity). Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts, thereby promoting their translation (By similarity). Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells (By similarity). Acts by binding and promoting translation of m6A-containing transcripts encoding proteins involved in lysosomal degradation and phagosome maturation, leading to increased antigen degradation in myeloid dendritic cells (By similarity). In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413537 | YTHDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413537 | Transient overexpression lysate of YTH domain family, member 1 (YTHDF1) |
CNY 3,080.00 |
|
PH307185 | YTHDF1 MS Standard C13 and N15-labeled recombinant protein (NP_060268) |
CNY 19,520.00 |