PPM1K (NM_152542) Human Recombinant Protein
CAT#: TP307144
Recombinant protein of human protein phosphatase 1K (PP2C domain containing) (PPM1K), 20 µg
View other "PPM1K" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207144 protein sequence
Red=Cloning site Green=Tags(s) MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR IDEPILLPPSIKYGKPIPKISLEKVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDSR AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG KYKNSEINFSFSRSFASSGRWA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689755 |
Locus ID | 152926 |
UniProt ID | Q8N3J5 |
Refseq Size | 6590 |
Cytogenetics | 4q22.1 |
Refseq ORF | 1116 |
Synonyms | BDP; MSUDMV; PP2Ckappa; PP2Cm; PTMP; UG0882E07 |
Summary | This gene encodes a member of the PPM family of Mn2+/Mg2+-dependent protein phosphatases. The encoded protein, essential for cell survival and development, is targeted to the mitochondria where it plays a key role in regulation of the mitochondrial permeability transition pore. [provided by RefSeq, Sep 2012] |
Protein Families | Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403474 | PPM1K HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403474 | Transient overexpression lysate of protein phosphatase 1K (PP2C domain containing) (PPM1K), nuclear gene encoding mitochondrial protein |
CN¥ 3,080.00 |
|
PH307144 | PPM1K MS Standard C13 and N15-labeled recombinant protein (NP_689755) |
CN¥ 19,520.00 |