ACYP1 (NM_001107) Human Recombinant Protein
CAT#: TP307110
Recombinant protein of human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, 20 µg
View other "ACYP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207110 protein sequence
Red=Cloning site Green=Tags(s) MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG SPKSHIDKANFNNEKVILKLDYSDFQIVK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001098 |
Locus ID | 97 |
UniProt ID | P07311 |
Refseq Size | 621 |
Cytogenetics | 14q24.3 |
Refseq ORF | 297 |
Synonyms | ACYPE |
Summary | This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Protein Pathways | Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420125 | ACYP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY420125 | Transient overexpression lysate of acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1 |
CN¥ 3,080.00 |
|
PH307110 | ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098) |
CN¥ 19,520.00 |