United States
Germany
Japan
United Kingdom
China
UBE2L6 (NM_198183) Human Recombinant Protein
CAT＃: TP307106
Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2, 20 µg
View other "UBE2L6" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207106 protein sequence
Red=Cloning site Green=Tags(s) MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA EEFTLRFGVDRPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 9.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_937826 |
| Locus ID | 9246 |
| UniProt ID | O14933 |
| Refseq Size | 1642 |
| Cytogenetics | 11q12.1 |
| Refseq ORF | 462 |
| Synonyms | RIG-B; UBCH8 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011] |
| Protein Pathways | Parkinson's disease, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401353 | UBE2L6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404883 | UBE2L6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401353 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 1 |
CNY 3,080.00 |
|
| LY404883 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2 |
CNY 3,080.00 |
|
| PH307106 | UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_937826) |
CNY 19,520.00 |
|
| PH312405 | UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_004214) |
CNY 19,520.00 |
|
| TP312405 | Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720968 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2 |
CNY 3,140.00 |
