HPD (NM_002150) Human Recombinant Protein
CAT#: TP306860
Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206860 protein sequence
Red=Cloning site Green=Tags(s) MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFV LSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYG DTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFW SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002141 |
Locus ID | 3242 |
UniProt ID | P32754 |
Refseq Size | 1440 |
Cytogenetics | 12q24.31 |
Refseq ORF | 1179 |
Synonyms | 4-HPPD; 4HPPD; GLOD3; HPPDASE; PPD |
Summary | The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419503 | HPD HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432928 | HPD HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419503 | Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1 |
CN¥ 3,080.00 |
|
LY432928 | Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2 |
CN¥ 3,080.00 |
|
PH306860 | HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141) |
CN¥ 19,520.00 |
|
TP720550 | Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2. |
CN¥ 1,800.00 |